Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (17 families) consists only of helices |
Family a.4.1.13: SLIDE domain [100998] (1 protein) myb-related probable DNA-binding motif |
Protein SLIDE domain of the nucleosome remodeling ATPase ISWI [100999] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101000] (1 PDB entry) |
Domain d1ofcx2: 1ofc X:851-978 [92827] Other proteins in same PDB: d1ofcx1, d1ofcx3 includes alpha-helical spacer, residues 851-891, separating SANT and SLIDE domains complexed with g4d, glc, gol |
PDB Entry: 1ofc (more details), 1.9 Å
SCOP Domain Sequences for d1ofcx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dierimgqiergegkiqrrlsikkaldqkmsryrapfhqlrlqygnnkgknyteiedrfl vcmlhklgfdkenvyeelraairaspqfrfdwfiksrtalelqrrcntlitliereniel eekeraek
Timeline for d1ofcx2: