SCOP 1.73: Domain d1ofcx2: 1ofc X:851-978

Lineage for d1ofcx2 (1ofc X:851-978)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.13: SLIDE domain [100998] (1 protein)
   myb-related probable DNA-binding motif

6. Protein SLIDE domain of the nucleosome remodeling ATPase ISWI [100999] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101000] (1 PDB entry)

8. Domain d1ofcx2: 1ofc X:851-978 [92827]
   Other proteins in same PDB: d1ofcx1, d1ofcx3
   includes alpha-helical spacer, residues 851-891, separating SANT and SLIDE domains
   complexed with g4d, glc, gol

Details for d1ofcx2

PDB Entry: 1ofc, 1.9 Å

PDB Description: nucleosome recognition module of iswi atpase

PDB Compounds: (X:) iswi protein

SCOP Domain Sequences for d1ofcx2:

Sequence; same for both SEQRES and ATOM records:

>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dierimgqiergegkiqrrlsikkaldqkmsryrapfhqlrlqygnnkgknyteiedrfl
vcmlhklgfdkenvyeelraairaspqfrfdwfiksrtalelqrrcntlitliereniel
eekeraek

Timeline for d1ofcx2:

• d1ofcx2 first appeared in SCOP 1.67
  
• d1ofcx2 appears in SCOP 1.71
  
• d1ofcx2 appears in SCOP 1.75
  
• d1ofcx2 appears in the current release, SCOPe 2.08