Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (17 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (13 proteins) |
Protein SANT domain of the nucleosome remodeling ATPase ISWI [100996] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100997] (1 PDB entry) |
Domain d1ofcx1: 1ofc X:799-850 [92826] Other proteins in same PDB: d1ofcx2, d1ofcx3 complexed with g4d, glc, gol |
PDB Entry: 1ofc (more details), 1.9 Å
SCOP Domain Sequences for d1ofcx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} awtkrdfnqfikanekygrddidniakdvegktpeevieynavfwerctelq
Timeline for d1ofcx1: