Lineage for d1ofcx1 (1ofc X:799-850)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634507Family a.4.1.3: Myb/SANT domain [46739] (13 proteins)
  6. 634566Protein SANT domain of the nucleosome remodeling ATPase ISWI [100996] (1 species)
  7. 634567Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100997] (1 PDB entry)
  8. 634568Domain d1ofcx1: 1ofc X:799-850 [92826]
    Other proteins in same PDB: d1ofcx2, d1ofcx3
    complexed with g4d, glc, gol

Details for d1ofcx1

PDB Entry: 1ofc (more details), 1.9 Å

PDB Description: nucleosome recognition module of iswi atpase
PDB Compounds: (X:) iswi protein

SCOP Domain Sequences for d1ofcx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
awtkrdfnqfikanekygrddidniakdvegktpeevieynavfwerctelq

SCOP Domain Coordinates for d1ofcx1:

Click to download the PDB-style file with coordinates for d1ofcx1.
(The format of our PDB-style files is described here.)

Timeline for d1ofcx1: