Lineage for d1oe9b_ (1oe9 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269357Protein Myosin Essential Chain [47524] (3 species)
  7. 1269385Species Human (Homo sapiens) [TaxId:9606] [101181] (2 PDB entries)
  8. 1269386Domain d1oe9b_: 1oe9 B: [92794]
    Other proteins in same PDB: d1oe9a1, d1oe9a2
    complexed with so4

Details for d1oe9b_

PDB Entry: 1oe9 (more details), 2.05 Å

PDB Description: crystal structure of myosin v motor with essential light chain - nucleotide-free
PDB Compounds: (B:) myosin light chain 1, slow-twitch muscle a isoform

SCOPe Domain Sequences for d1oe9b_:

Sequence, based on SEQRES records: (download)

>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}
fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr
rvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmtee
evetvlaghedsngcinyeaflkhils

Sequence, based on observed residues (ATOM records): (download)

>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}
fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr
rvdfetflpmlqavakyedylegfrvfdgngkvmgaelrhvlttlgekmteeevetvlag
hedsngcinyeaflkhils

SCOPe Domain Coordinates for d1oe9b_:

Click to download the PDB-style file with coordinates for d1oe9b_.
(The format of our PDB-style files is described here.)

Timeline for d1oe9b_: