SCOP 1.67: Domain d1oe9a1: 1oe9 A:5-62

Lineage for d1oe9a1 (1oe9 A:5-62)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (1 PDB entry)

8. Domain d1oe9a1: 1oe9 A:5-62 [92792]
   Other proteins in same PDB: d1oe9a2, d1oe9b_
   complexed with so4

Details for d1oe9a1

PDB Entry: 1oe9, 2.05 Å

PDB Description: crystal structure of myosin v motor with essential light chain - nucleotide-free

SCOP Domain Sequences for d1oe9a1:

Sequence, based on SEQRES records:

>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

Sequence, based on observed residues (ATOM records):

>d1oe9a1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleyclkelppl

Timeline for d1oe9a1:

• d1oe9a1 is new in SCOP 1.67
  
• d1oe9a1 appears in SCOP 1.69
  
• d1oe9a1 appears in the current release, SCOPe 2.08