Lineage for d1odua1 (1odu A:357-447)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960875Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 960876Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 961348Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein)
    glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10)
  6. 961349Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species)
  7. 961350Species Thermotoga maritima [TaxId:2336] [101930] (3 PDB entries)
    TM0306
  8. 961355Domain d1odua1: 1odu A:357-447 [92784]
    Other proteins in same PDB: d1odua2, d1odub2
    complexed with ful

Details for d1odua1

PDB Entry: 1odu (more details), 2.8 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
PDB Compounds: (A:) putative alpha-l-fucosidase

SCOPe Domain Sequences for d1odua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odua1 b.71.1.3 (A:357-447) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOPe Domain Coordinates for d1odua1:

Click to download the PDB-style file with coordinates for d1odua1.
(The format of our PDB-style files is described here.)

Timeline for d1odua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1odua2