SCOP 1.67: Domain d1odua1: 1odu A:357-447

Lineage for d1odua1 (1odu A:357-447)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein)
   glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10)

6. Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [101930] (3 PDB entries)
   TM0306

8. Domain d1odua1: 1odu A:357-447 [92784]
   Other proteins in same PDB: d1odua2, d1odub2

Details for d1odua1

PDB Entry: 1odu, 2.8 Å

PDB Description: crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose

SCOP Domain Sequences for d1odua1:

Sequence; same for both SEQRES and ATOM records:

>d1odua1 b.71.1.3 (A:357-447) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

Timeline for d1odua1:

• d1odua1 is new in SCOP 1.67
  
• d1odua1 appears in SCOP 1.69
  
• d1odua1 appears in the current release, SCOPe 2.08