Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (17 species) |
Species Plasmodium berghei [TaxId:5821] [102165] (1 PDB entry) |
Domain d1oc4b1: 1oc4 B:18-163 [92772] Other proteins in same PDB: d1oc4a2, d1oc4b2 complexed with gol, nad, oxm |
PDB Entry: 1oc4 (more details), 2.3 Å
SCOPe Domain Sequences for d1oc4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oc4b1 c.2.1.5 (B:18-163) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]} apkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnckv sgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpnaf iivvtnpvdvmvqllhqhsgvpknkivgl
Timeline for d1oc4b1: