SCOP 1.71: Domain d1obaa2: 1oba A:2-190

Lineage for d1obaa2 (1oba A:2-190)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins)
   Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
   permutation of the common fold; strand 8 is antiparallel to the rest of the barrel

6. Protein N-terminal domain of endolysin [89484] (1 species)

7. Species Bacteriophage cp-1 [TaxId:10747] [89485] (2 PDB entries)

8. Domain d1obaa2: 1oba A:2-190 [92754]
   Other proteins in same PDB: d1obaa1
   complexed with cht

Details for d1obaa2

PDB Entry: 1oba, 2.45 Å

PDB Description: multimodular pneumococcal cell wall endolysin from phage cp-1 complexed with choline

SCOP Domain Sequences for d1obaa2:

Sequence; same for both SEQRES and ATOM records:

>d1obaa2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnrclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyeddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd

Timeline for d1obaa2:

• d1obaa2 first appeared in SCOP 1.67
  
• d1obaa2 appears in SCOP 1.69
  
• d1obaa2 appears in SCOP 1.73
  
• d1obaa2 appears in the current release, SCOPe 2.08