SCOPe 2.06: Domain d1oazl_: 1oaz L:

Lineage for d1oazl_ (1oaz L:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)

8. Domain d1oazl_: 1oaz L: [92745]
   Other proteins in same PDB: d1oaza_, d1oazb_, d1oazh_, d1oazj_
   part of IgE Fv spe-7

Details for d1oazl_

PDB Entry: 1oaz, 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin

PDB Compounds: (L:) immunoglobulin e

SCOPe Domain Sequences for d1oazl_:

Sequence; same for both SEQRES and ATOM records:

>d1oazl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d1oazl_:

• d1oazl_ first appeared in SCOP 1.67
  
• d1oazl_ appears in SCOPe 2.05
  
• d1oazl_ appears in SCOPe 2.07
  
• d1oazl_ appears in the current release, SCOPe 2.08