Lineage for d1oazl_ (1oaz L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364057Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 364181Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 364200Domain d1oazl_: 1oaz L: [92745]
    Other proteins in same PDB: d1oaza_, d1oazb_, d1oazh_, d1oazj_

Details for d1oazl_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin

SCOP Domain Sequences for d1oazl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oazl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOP Domain Coordinates for d1oazl_:

Click to download the PDB-style file with coordinates for d1oazl_.
(The format of our PDB-style files is described here.)

Timeline for d1oazl_: