Lineage for d1oazj_ (1oaz J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288551Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 1288583Domain d1oazj_: 1oaz J: [92744]
    Other proteins in same PDB: d1oaza_, d1oazb_, d1oazl_, d1oazn_
    part of IgE Fv spe-7

Details for d1oazj_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin
PDB Compounds: (J:) immunoglobulin e

SCOPe Domain Sequences for d1oazj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oazj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

SCOPe Domain Coordinates for d1oazj_:

Click to download the PDB-style file with coordinates for d1oazj_.
(The format of our PDB-style files is described here.)

Timeline for d1oazj_: