Lineage for d1oazh_ (1oaz H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022524Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 2022555Domain d1oazh_: 1oaz H: [92743]
    Other proteins in same PDB: d1oaza_, d1oazb_, d1oazl_, d1oazn_
    part of IgE Fv spe-7

Details for d1oazh_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin
PDB Compounds: (H:) immunoglobulin e

SCOPe Domain Sequences for d1oazh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oazh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

SCOPe Domain Coordinates for d1oazh_:

Click to download the PDB-style file with coordinates for d1oazh_.
(The format of our PDB-style files is described here.)

Timeline for d1oazh_: