Lineage for d1oaza_ (1oaz A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600409Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1600473Protein Thioredoxin [52835] (15 species)
  7. 1600489Species Escherichia coli [TaxId:562] [52836] (47 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 1600569Domain d1oaza_: 1oaz A: [92741]
    Other proteins in same PDB: d1oazh_, d1oazj_, d1oazl_, d1oazn_
    insertion mutant

Details for d1oaza_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d1oaza_:

Sequence, based on SEQRES records: (download)

>d1oaza_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeia
deyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldan
la

Sequence, based on observed residues (ATOM records): (download)

>d1oaza_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeil
tvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d1oaza_:

Click to download the PDB-style file with coordinates for d1oaza_.
(The format of our PDB-style files is described here.)

Timeline for d1oaza_: