Lineage for d1oaza_ (1oaz A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584502Family c.47.1.1: Thioltransferase [52834] (13 proteins)
  6. 584553Protein Thioredoxin [52835] (12 species)
  7. 584578Species Escherichia coli [TaxId:562] [52836] (25 PDB entries)
  8. 584609Domain d1oaza_: 1oaz A: [92741]
    Other proteins in same PDB: d1oazh_, d1oazj_, d1oazl_, d1oazn_

Details for d1oaza_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin

SCOP Domain Sequences for d1oaza_:

Sequence, based on SEQRES records: (download)

>d1oaza_ c.47.1.1 (A:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeia
deyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldan
la

Sequence, based on observed residues (ATOM records): (download)

>d1oaza_ c.47.1.1 (A:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeil
tvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1oaza_:

Click to download the PDB-style file with coordinates for d1oaza_.
(The format of our PDB-style files is described here.)

Timeline for d1oaza_: