SCOPe 2.06: Domain d1oayn_: 1oay N:

Lineage for d1oayn_ (1oay N:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)

8. Domain d1oayn_: 1oay N: [92739]
   Other proteins in same PDB: d1oayh_, d1oayj_
   part of IgE Fv spe-7
   complexed with fur

Details for d1oayn_

PDB Entry: 1oay, 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity

PDB Compounds: (N:) immunoglobulin e

SCOPe Domain Sequences for d1oayn_:

Sequence, based on SEQRES records:

>d1oayn_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Sequence, based on observed residues (ATOM records):

>d1oayn_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvpa
rfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d1oayn_:

• d1oayn_ first appeared in SCOP 1.67
  
• d1oayn_ appears in SCOPe 2.05
  
• d1oayn_ appears in SCOPe 2.07
  
• d1oayn_ appears in the current release, SCOPe 2.08