SCOP 1.69: Domain d1oayl_: 1oay L:

Lineage for d1oayl_ (1oay L:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)

8. Domain d1oayl_: 1oay L: [92737]
   Other proteins in same PDB: d1oayh_, d1oayi_, d1oayj_, d1oayk_

Details for d1oayl_

PDB Entry: 1oay, 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity

SCOP Domain Sequences for d1oayl_:

Sequence; same for both SEQRES and ATOM records:

>d1oayl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d1oayl_:

• d1oayl_ first appeared in SCOP 1.67
  
• d1oayl_ appears in SCOP 1.71
  
• d1oayl_ appears in the current release, SCOPe 2.08