SCOP 1.67: Domain d1oayi_: 1oay I:

Lineage for d1oayi_ (1oay I:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)

8. Domain d1oayi_: 1oay I: [92734]
   Other proteins in same PDB: d1oayl_, d1oaym_, d1oayn_, d1oayo_

Details for d1oayi_

PDB Entry: 1oay, 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity

SCOP Domain Sequences for d1oayi_:

Sequence; same for both SEQRES and ATOM records:

>d1oayi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkyn
lkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvssa
a

Timeline for d1oayi_:

• d1oayi_ is new in SCOP 1.67
  
• d1oayi_ appears in SCOP 1.69
  
• d1oayi_ last appears in SCOP 1.73