SCOP 1.67: Domain d1oaxm_: 1oax M:

Lineage for d1oaxm_ (1oax M:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)

8. Domain d1oaxm_: 1oax M: [92730]
   Other proteins in same PDB: d1oaxh_, d1oaxi_, d1oaxj_, d1oaxk_

Details for d1oaxm_

PDB Entry: 1oax, 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

SCOP Domain Sequences for d1oaxm_:

Sequence; same for both SEQRES and ATOM records:

>d1oaxm_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d1oaxm_:

• d1oaxm_ is new in SCOP 1.67
  
• d1oaxm_ appears in SCOP 1.69
  
• d1oaxm_ appears in the current release, SCOPe 2.08