SCOP 1.75: Domain d1oaxl_: 1oax L:

Lineage for d1oaxl_ (1oax L:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (8 PDB entries)

8. Domain d1oaxl_: 1oax L: [92729]
   Other proteins in same PDB: d1oaxh_, d1oaxj_
   part of IgE Fv spe-7

Details for d1oaxl_

PDB Entry: 1oax, 2.67 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

PDB Compounds: (L:) immunoglobulin e

SCOP Domain Sequences for d1oaxl_:

Sequence; same for both SEQRES and ATOM records:

>d1oaxl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Timeline for d1oaxl_:

• d1oaxl_ first appeared in SCOP 1.67
  
• d1oaxl_ appears in SCOP 1.73
  
• d1oaxl_ appears in SCOPe 2.01
  
• d1oaxl_ appears in the current release, SCOPe 2.08