SCOP 1.73: Domain d1oaxk_: 1oax K:

Lineage for d1oaxk_ (1oax K:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (15 PDB entries)

8. Domain d1oaxk_: 1oax K: [92728]
   Other proteins in same PDB: d1oaxl_, d1oaxm_, d1oaxn_, d1oaxo_
   part of IgE Fv spe-7
   complexed with anq

Details for d1oaxk_

PDB Entry: 1oax, 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

SCOP Domain Sequences for d1oaxk_:

Sequence; same for both SEQRES and ATOM records:

>d1oaxk_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

Timeline for d1oaxk_:

• d1oaxk_ first appeared in SCOP 1.67
  
• d1oaxk_ appears in SCOP 1.71
  
• d1oaxk_ does not appear in SCOP 1.75