SCOP 1.75: Domain d1oaxh_: 1oax H:

Lineage for d1oaxh_ (1oax H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1oaxh_: 1oax H: [92725]
   Other proteins in same PDB: d1oaxl_, d1oaxm_, d1oaxn_, d1oaxo_
   part of IgE Fv spe-7

Details for d1oaxh_

PDB Entry: 1oax, 2.67 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

PDB Compounds: (H:) immunoglobulin e

SCOP Domain Sequences for d1oaxh_:

Sequence; same for both SEQRES and ATOM records:

>d1oaxh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

Timeline for d1oaxh_:

• d1oaxh_ first appeared in SCOP 1.67
  
• d1oaxh_ appears in SCOP 1.73
  
• d1oaxh_ appears in SCOPe 2.01
  
• d1oaxh_ appears in the current release, SCOPe 2.08