Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries) |
Domain d1oauo_: 1oau O: [92724] Other proteins in same PDB: d1oauh_, d1oaui_, d1oauj_, d1oauk_ part of IgE Fv spe-7 complexed with dnf, imd, ser |
PDB Entry: 1oau (more details), 1.8 Å
SCOPe Domain Sequences for d1oauo_:
Sequence, based on SEQRES records: (download)
>d1oauo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]} qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs gslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
>d1oauo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]} qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs gslignkaaltitgaqtedeaiyfcgtkltvl
Timeline for d1oauo_: