Lineage for d1oaun_ (1oau N:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364057Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 364181Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 364185Domain d1oaun_: 1oau N: [92723]
    Other proteins in same PDB: d1oauh_, d1oaui_, d1oauj_, d1oauk_

Details for d1oaun_

PDB Entry: 1oau (more details), 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oaun_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaun_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOP Domain Coordinates for d1oaun_:

Click to download the PDB-style file with coordinates for d1oaun_.
(The format of our PDB-style files is described here.)

Timeline for d1oaun_: