SCOP 1.75: Domain d1oauk_: 1oau K:

Lineage for d1oauk_ (1oau K:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1oauk_: 1oau K: [92720]
   Other proteins in same PDB: d1oaul_, d1oaum_, d1oaun_, d1oauo_
   part of IgE Fv spe-7
   complexed with dnf, imd, ser

Details for d1oauk_

PDB Entry: 1oau, 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

PDB Compounds: (K:) immunoglobulin e

SCOP Domain Sequences for d1oauk_:

Sequence, based on SEQRES records:

>d1oauk_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
gaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfksk
atltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Sequence, based on observed residues (ATOM records):

>d1oauk_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
gavkrpamvyycarmdwgttvs

Timeline for d1oauk_:

• d1oauk_ first appeared in SCOP 1.67
  
• d1oauk_ appears in SCOP 1.73
  
• d1oauk_ appears in SCOPe 2.01
  
• d1oauk_ appears in the current release, SCOPe 2.08