Lineage for d1oauk_ (1oau K:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363391Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 363398Domain d1oauk_: 1oau K: [92720]
    Other proteins in same PDB: d1oaul_, d1oaum_, d1oaun_, d1oauo_
    part of IgE Fv spe-7
    complexed with dnf, imd, ser

Details for d1oauk_

PDB Entry: 1oau (more details), 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oauk_:

Sequence, based on SEQRES records: (download)

>d1oauk_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfksk
atltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1oauk_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gavkrpamvyycarmdwgttvs

SCOP Domain Coordinates for d1oauk_:

Click to download the PDB-style file with coordinates for d1oauk_.
(The format of our PDB-style files is described here.)

Timeline for d1oauk_: