SCOP 1.71: Domain d1oaui_: 1oau I:

Lineage for d1oaui_ (1oau I:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)

8. Domain d1oaui_: 1oau I: [92718]
   Other proteins in same PDB: d1oaul_, d1oaum_, d1oaun_, d1oauo_

Details for d1oaui_

PDB Entry: 1oau, 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oaui_:

Sequence, based on SEQRES records:

>d1oaui_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfksk
atltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvs

Sequence, based on observed residues (ATOM records):

>d1oaui_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gavkhrpamvyycarmfgttvs

Timeline for d1oaui_:

• d1oaui_ first appeared in SCOP 1.67
  
• d1oaui_ appears in SCOP 1.69
  
• d1oaui_ appears in SCOP 1.73
  
• d1oaui_ appears in the current release, SCOPe 2.08