Lineage for d1oaui_ (1oau I:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363391Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 363396Domain d1oaui_: 1oau I: [92718]
    Other proteins in same PDB: d1oaul_, d1oaum_, d1oaun_, d1oauo_

Details for d1oaui_

PDB Entry: 1oau (more details), 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oaui_:

Sequence, based on SEQRES records: (download)

>d1oaui_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfksk
atltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvs

Sequence, based on observed residues (ATOM records): (download)

>d1oaui_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
gavkhrpamvyycarmfgttvs

SCOP Domain Coordinates for d1oaui_:

Click to download the PDB-style file with coordinates for d1oaui_.
(The format of our PDB-style files is described here.)

Timeline for d1oaui_: