Lineage for d1oarn_ (1oar N:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757501Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1757640Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 1757648Domain d1oarn_: 1oar N: [92715]
    Other proteins in same PDB: d1oarh_, d1oari_, d1oarj_, d1oark_
    part of IgE Fv spe-7
    complexed with azn, cac, cl, dms, edo, na

Details for d1oarn_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red
PDB Compounds: (N:) immunoglobuling e

SCOPe Domain Sequences for d1oarn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oarn_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOPe Domain Coordinates for d1oarn_:

Click to download the PDB-style file with coordinates for d1oarn_.
(The format of our PDB-style files is described here.)

Timeline for d1oarn_: