Lineage for d1oark_ (1oar K:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652945Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (15 PDB entries)
  8. 652957Domain d1oark_: 1oar K: [92712]
    Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_
    part of IgE Fv spe-7
    complexed with azn, cac, cl, dms, edo, na

Details for d1oark_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red
PDB Compounds: (K:) immunoglobulin e

SCOP Domain Sequences for d1oark_:

Sequence, based on SEQRES records: (download)

>d1oark_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
pgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfkskatltvd
kpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttl

Sequence, based on observed residues (ATOM records): (download)

>d1oark_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
pgasvklscktsywmhwvkqrlewigridgtkynekfkskatltvstaymqlssldsavy
ycarmwyygtyyfdywgqgttl

SCOP Domain Coordinates for d1oark_:

Click to download the PDB-style file with coordinates for d1oark_.
(The format of our PDB-style files is described here.)

Timeline for d1oark_: