| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
| Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries) |
| Domain d1oark_: 1oar K: [92712] Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_ part of IgE Fv spe-7 complexed with azn, cac, cl, dms, edo, na |
PDB Entry: 1oar (more details), 2.22 Å
SCOP Domain Sequences for d1oark_:
Sequence, based on SEQRES records: (download)
>d1oark_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
pgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfkskatltvd
kpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttl
>d1oark_ b.1.1.1 (K:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
pgasvklscktsywmhwvkqrlewigridgtkynekfkskatltvstaymqlssldsavy
ycarmwyygtyyfdywgqgttl
Timeline for d1oark_: