Lineage for d1oarh_ (1oar H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022524Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 2022533Domain d1oarh_: 1oar H: [92709]
    Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_
    part of IgE Fv spe-7
    complexed with azn, cac, cl, dms, edo, na

Details for d1oarh_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red
PDB Compounds: (H:) immunoglobulin e

SCOPe Domain Sequences for d1oarh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oarh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

SCOPe Domain Coordinates for d1oarh_:

Click to download the PDB-style file with coordinates for d1oarh_.
(The format of our PDB-style files is described here.)

Timeline for d1oarh_: