SCOPe 2.01: Domain d1oaea_: 1oae A:

Lineage for d1oaea_ (1oae A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c'' [68950] (1 species)
   close homologue of SHP

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (3 PDB entries)

8. Domain d1oaea_: 1oae A: [92704]
   complexed with gol, hec, so4

Details for d1oaea_

PDB Entry: 1oae, 1.95 Å

PDB Description: crystal structure of the reduced form of cytochrome c" from methylophilus methylotrophus

PDB Compounds: (A:) cytochrome c"

SCOPe Domain Sequences for d1oaea_:

Sequence; same for both SEQRES and ATOM records:

>d1oaea_ a.3.1.1 (A:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kptk

Timeline for d1oaea_:

• d1oaea_ first appeared in SCOP 1.67
  
• d1oaea_ appears in SCOP 1.75
  
• d1oaea_ appears in SCOPe 2.02
  
• d1oaea_ appears in the current release, SCOPe 2.08