Lineage for d1o9ua_ (1o9u A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220799Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 1220800Species Human (Homo sapiens) [TaxId:9606] [69824] (23 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 1220825Domain d1o9ua_: 1o9u A: [92691]
    complexed with axin peptide
    complexed with adz

Details for d1o9ua_

PDB Entry: 1o9u (more details), 2.4 Å

PDB Description: glycogen synthase kinase 3 beta complexed with axin peptide
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1o9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9ua_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpatvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

SCOPe Domain Coordinates for d1o9ua_:

Click to download the PDB-style file with coordinates for d1o9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ua_: