SCOP 1.67: Domain d1o9tb2: 1o9t B:129-252

Lineage for d1o9tb2 (1o9t B:129-252)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)

6. Protein S-adenosylmethionine synthetase [55975] (2 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)

8. Domain d1o9tb2: 1o9t B:129-252 [92689]

Details for d1o9tb2

PDB Entry: 1o9t, 2.9 Å

PDB Description: methionine adenosyltransferase complexed with both substrates atp and methionine

SCOP Domain Sequences for d1o9tb2:

Sequence; same for both SEQRES and ATOM records:

>d1o9tb2 d.130.1.1 (B:129-252) S-adenosylmethionine synthetase {Rat (Rattus norvegicus)}
edvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvq
yvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqps
grfv

Timeline for d1o9tb2:

• d1o9tb2 is new in SCOP 1.67
  
• d1o9tb2 appears in SCOP 1.69
  
• d1o9tb2 appears in the current release, SCOPe 2.08