Lineage for d1o7ra_ (1o7r A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589782Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 589783Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) (S)
  5. 589982Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 589983Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 589984Species Cow (Bos taurus) [TaxId:9913] [64133] (13 PDB entries)
  8. 590001Domain d1o7ra_: 1o7r A: [92628]

Details for d1o7ra_

PDB Entry: 1o7r (more details), 2 Å

PDB Description: roles on individual residues of alpha-1,3 galactosyltransferases in substrate binding and catalysis

SCOP Domain Sequences for d1o7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ra_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus)}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqagwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

SCOP Domain Coordinates for d1o7ra_:

Click to download the PDB-style file with coordinates for d1o7ra_.
(The format of our PDB-style files is described here.)

Timeline for d1o7ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o7rb_