Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) |
Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein) |
Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species) dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme |
Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries) |
Domain d1o68b_: 1o68 B: [92556] |
PDB Entry: 1o68 (more details), 2.1 Å
SCOP Domain Sequences for d1o68b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o68b_ c.1.12.8 (B:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis} slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq aavrayvaevkaktfpaaehif
Timeline for d1o68b_:
View in 3D Domains from other chains: (mouse over for more information) d1o68a_, d1o68c_, d1o68d_, d1o68e_ |