Lineage for d1o68b_ (1o68 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573323Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 573324Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 573342Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 573349Domain d1o68b_: 1o68 B: [92556]

Details for d1o68b_

PDB Entry: 1o68 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOP Domain Sequences for d1o68b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o68b_ c.1.12.8 (B:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis}
slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
aavrayvaevkaktfpaaehif

SCOP Domain Coordinates for d1o68b_:

Click to download the PDB-style file with coordinates for d1o68b_.
(The format of our PDB-style files is described here.)

Timeline for d1o68b_: