Lineage for d1o5wd1 (1o5w D:3010-3298,D:3411-3515)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822426Protein Monoamine oxidase B [69423] (2 species)
  7. 822466Species Rat (Rattus norvegicus) [TaxId:10116] [102180] (14 PDB entries)
  8. 822496Domain d1o5wd1: 1o5w D:3010-3298,D:3411-3515 [92526]
    Other proteins in same PDB: d1o5wa2, d1o5wb2, d1o5wc2, d1o5wd2
    complexed with fad, mlg

Details for d1o5wd1

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
PDB Compounds: (D:) Amine oxidase [flavin-containing] A

SCOP Domain Sequences for d1o5wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wd1 c.3.1.2 (D:3010-3298,D:3411-3515) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlXfppgimtqyg
rvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskd
vpaieithtflernlpsvpgllkitgvstsvallc

SCOP Domain Coordinates for d1o5wd1:

Click to download the PDB-style file with coordinates for d1o5wd1.
(The format of our PDB-style files is described here.)

Timeline for d1o5wd1: