Lineage for d1o4zc_ (1o4z C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307778Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 1307808Protein beta-Agarase A [101636] (1 species)
  7. 1307809Species Zobellia galactanivorans [TaxId:63186] [101637] (3 PDB entries)
  8. 1307814Domain d1o4zc_: 1o4z C: [92476]
    complexed with epe, mg, na

Details for d1o4zc_

PDB Entry: 1o4z (more details), 2.3 Å

PDB Description: the three-dimensional structure of beta-agarase b from zobellia galactanivorans
PDB Compounds: (C:) beta-agarase B

SCOPe Domain Sequences for d1o4zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4zc_ b.29.1.2 (C:) beta-Agarase A {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek

SCOPe Domain Coordinates for d1o4zc_:

Click to download the PDB-style file with coordinates for d1o4zc_.
(The format of our PDB-style files is described here.)

Timeline for d1o4zc_: