Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries) |
Domain d1o4la_: 1o4l A: [92463] complexed with cit |
PDB Entry: 1o4l (more details), 1.65 Å
SCOPe Domain Sequences for d1o4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4la_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
Timeline for d1o4la_: