Lineage for d1o4ea_ (1o4e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965253Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 2965282Domain d1o4ea_: 1o4e A: [92456]
    complexed with 299

Details for d1o4ea_

PDB Entry: 1o4e (more details), 2 Å

PDB Description: crystal structure of sh2 in complex with ru78299.
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1o4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4ea_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

SCOPe Domain Coordinates for d1o4ea_:

Click to download the PDB-style file with coordinates for d1o4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1o4ea_: