SCOP 1.75: Domain d1o4ba_: 1o4b A:

Lineage for d1o4ba_ (1o4b A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (42 PDB entries)

8. Domain d1o4ba_: 1o4b A: [92453]
   complexed with 876

Details for d1o4ba_

PDB Entry: 1o4b, 1.85 Å

PDB Description: crystal structure of sh2 in complex with ru83876.

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d1o4ba_:

Sequence; same for both SEQRES and ATOM records:

>d1o4ba_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

Timeline for d1o4ba_:

• d1o4ba_ first appeared in SCOP 1.67
  
• d1o4ba_ appears in SCOP 1.73
  
• d1o4ba_ appears in SCOPe 2.01
  
• d1o4ba_ appears in the current release, SCOPe 2.08