Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (28 proteins) |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries) |
Domain d1o48a_: 1o48 A: [92450] complexed with 853 |
PDB Entry: 1o48 (more details), 1.55 Å
SCOP Domain Sequences for d1o48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)} siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt
Timeline for d1o48a_: