SCOP 1.75: Domain d1nzbe1: 1nzb E:21-129

Lineage for d1nzbe1 (1nzb E:21-129)

Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds)
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
Protein Cre recombinase [47825] (1 species)
Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
Uniprot P06956 20-341
Domain d1nzbe1: 1nzb E:21-129 [92369]
Other proteins in same PDB: d1nzba2, d1nzbb2, d1nzbe2, d1nzbf2

Details for d1nzbe1

PDB Entry: 1nzb (more details), 3.1 Å

PDB Description: Crystal structure of wild type Cre recombinase-loxP synapse

PDB Compounds: (E:) cre recombinase

SCOP Domain Sequences for d1nzbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzbe1 a.60.9.1 (E:21-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
devrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylqa
rglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1nzbe1:

Click to download the PDB-style file with coordinates for d1nzbe1.
(The format of our PDB-style files is described here.)

Timeline for d1nzbe1: