Lineage for d1nyya_ (1nyy A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244449Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)
  8. 2244488Domain d1nyya_: 1nyy A: [92362]
    complexed with 105; mutant

Details for d1nyya_

PDB Entry: 1nyy (more details), 1.9 Å

PDB Description: crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (105)
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1nyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyya_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1nyya_:

Click to download the PDB-style file with coordinates for d1nyya_.
(The format of our PDB-style files is described here.)

Timeline for d1nyya_: