SCOPe 2.05: Domain d1nyma_: 1nym A:

Lineage for d1nyma_ (1nym A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (47 PDB entries)

8. Domain d1nyma_: 1nym A: [92344]
   complexed with cxb, k, po4; mutant

Details for d1nyma_

PDB Entry: 1nym, 1.2 Å

PDB Description: crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (cxb)

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1nyma_:

Sequence; same for both SEQRES and ATOM records:

>d1nyma_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1nyma_:

• d1nyma_ first appeared in SCOP 1.67
  
• d1nyma_ appears in SCOPe 2.04
  
• d1nyma_ appears in SCOPe 2.06
  
• d1nyma_ appears in the current release, SCOPe 2.08