SCOP 1.71: Domain d1nyaa_: 1nya A:

Lineage for d1nyaa_ (1nya A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calerythrin [101179] (1 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Saccharopolyspora erythraea [TaxId:1836] [101180] (1 PDB entry)

8. Domain d1nyaa_: 1nya A: [92335]
   complexed with ca; mutant

Details for d1nyaa_

PDB Entry: 1nya

PDB Description: nmr solution structure of calerythrin, an ef-hand calcium-binding protein

SCOP Domain Sequences for d1nyaa_:

Sequence; same for both SEQRES and ATOM records:

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea}
ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf
dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin
adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg

Timeline for d1nyaa_:

• d1nyaa_ first appeared in SCOP 1.67
  
• d1nyaa_ appears in SCOP 1.69
  
• d1nyaa_ appears in SCOP 1.73
  
• d1nyaa_ appears in the current release, SCOPe 2.08