SCOP 1.73: Domain d1ny5b1: 1ny5 B:1-137

Lineage for d1ny5b1 (1ny5 B:1-137)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Transcriptional activator sigm54 (NtrC1), N-terminal domain [102230] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [102231] (2 PDB entries)

8. Domain d1ny5b1: 1ny5 B:1-137 [92319]
   Other proteins in same PDB: d1ny5a2, d1ny5b2
   complexed with adp, gol, mg, po4

Details for d1ny5b1

PDB Entry: 1ny5, 2.4 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state

PDB Compounds: (B:) transcriptional regulator (NtrC family)

SCOP Domain Sequences for d1ny5b1:

Sequence; same for both SEQRES and ATOM records:

>d1ny5b1 c.23.1.1 (B:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
lrkenellrrekdlkee

Timeline for d1ny5b1:

• d1ny5b1 first appeared in SCOP 1.67
  
• d1ny5b1 appears in SCOP 1.71
  
• d1ny5b1 appears in SCOP 1.75
  
• d1ny5b1 appears in the current release, SCOPe 2.08