Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Transcriptional activator sigm54 (NtrC1), N-terminal domain [102230] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [102231] (2 PDB entries) |
Domain d1ny5b1: 1ny5 B:1-137 [92319] Other proteins in same PDB: d1ny5a2, d1ny5b2 complexed with adp, gol, mg, po4 |
PDB Entry: 1ny5 (more details), 2.4 Å
SCOPe Domain Sequences for d1ny5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny5b1 c.23.1.1 (B:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk lrkenellrrekdlkee
Timeline for d1ny5b1: