Lineage for d1nxwa_ (1nxw A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691678Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 691679Species Streptococcus pneumoniae [TaxId:1313] [102233] (11 PDB entries)
  8. 691684Domain d1nxwa_: 1nxw A: [92311]
    complexed with acy

Details for d1nxwa_

PDB Entry: 1nxw (more details), 1.92 Å

PDB Description: MicArec pH 5.1
PDB Compounds: (A:) DNA-binding response regulator

SCOP Domain Sequences for d1nxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxwa_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrs

SCOP Domain Coordinates for d1nxwa_:

Click to download the PDB-style file with coordinates for d1nxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1nxwa_: