SCOP 1.73: Domain d1nxkd_: 1nxk D:

Lineage for d1nxkd_ (1nxk D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
   CaMK group; MAPKAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82790] (5 PDB entries)

8. Domain d1nxkd_: 1nxk D: [92305]
   complexed with so4, stu

Details for d1nxkd_

PDB Entry: 1nxk, 2.7 Å

PDB Description: Crystal structure of staurosporine bound to MAP KAP kinase 2

PDB Compounds: (D:) MAP kinase-activated protein kinase 2

SCOP Domain Sequences for d1nxkd_:

Sequence, based on SEQRES records:

>d1nxkd_ d.144.1.7 (D:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftere
aseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsltt
pcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmg
qyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl

Sequence, based on observed residues (ATOM records):

>d1nxkd_ d.144.1.7 (D:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettcytpyyvapev
lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl

Timeline for d1nxkd_:

• d1nxkd_ first appeared in SCOP 1.67
  
• d1nxkd_ appears in SCOP 1.71
  
• d1nxkd_ appears in SCOP 1.75
  
• d1nxkd_ appears in the current release, SCOPe 2.08